-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSTT2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-244 of human GSTT2B (NP_001074312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GSTT2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-244 of human GSTT2B (NP_001074312.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04949A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSTT2B |
| Target Synonyms | GSTT2P; GSTT2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 115-244 of human GSTT2B (NP_001074312.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP | Uniprot ID | P0CG30 |
Uniprot Id
P0CG30
Target Species
Human
Target Name
GSTT2B
Target Full Name
Glutathione S-transferase theta-2B
Target Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
Target Subcellular Location
Cytoplasm.
Target Protein Families
GST superfamily, Theta family
Target Tissue Specificity
Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
Target Synonyms
AI266894; EC 2.5.1.18; Glutathione S transferase 12; Glutathione S transferase Yrs Yrs; Glutathione S-transferase theta-2; Glutathione S-transferase theta-2B; GST 12 12; GST class theta 2; GST class-theta-2; GST T2; GSTT 2; GSTT2; GSTT2 protein; GSTT2_HUMAN; GSTT2B; GSTT2P; MGC182032; mGSTT2; OTTHUMP00000198491; OTTHUMP00000198492; Yrs
Target Background
The protein encoded by this gene, glutathione S-transferase (GST) theta 2B (GSTT2B), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2B gene is a pseudogene in some populations.
Notification