Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA2 (NP_003474.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HMGA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA2 (NP_003474.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of various lysates, using HMGA2 Rabbit mAb at 1:8000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-16437A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGA2 |
| Target Synonyms | BABL; LIPO; SRS5; HMGIC; HMGI-C; STQTL9; HMGA2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, RAW264.7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA2 (NP_003474.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEET | Uniprot ID | P52926 |
Uniprot Id
P52926
Target Species
Human
Target Name
HMGA2
Target Full Name
High mobility group protein HMGI-C
Target Function
Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation. Positively regulates IGF2 expression through PLAG1 and in a PLAG1-independent manner.
Target Involvement
A chromosomal aberration involving HMGA2 is associated with a subclass of benign mesenchymal tumors known as lipomas. Translocation t(3;12)(q27-q28;q13-q15) with LPP is shown in lipomas. HMGA2 is also fused with a number of other genes in lipomas.
Target Subcellular Location
Nucleus.
Target Protein Families
HMGA family
Target Synonyms
HMGA 2; BABL; High mobility group (nonhistone chromosomal) protein isoform I C; High mobility group (nonhistone chromosomal) protein isoform IC; High Mobility Group AT hook 2; High Mobility Group AT hook protein 2; High mobility group AT-hook protein 2; High mobility group protein HMGI C; High mobility group protein HMGI-C; High mobility group protein HMGIC; High mobility group protein I, isoform C; HMGA2; HMGA2_HUMAN; HMGI C; HMGIC; LIPO; Non histone chromosomal architectural protein HMGI C; Non histone chromosomal architectural protein HMGIC; Pygmy; STQTL9
Target Background
This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
