Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human HMGN2 (NP_005508.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HMGN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human HMGN2 (NP_005508.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09524A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGN2 |
| Target Synonyms | HMG17; HMGN2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human HMGN2 (NP_005508.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK | Uniprot ID | P05204 |
Uniprot Id
P05204
Target Species
Human
Target Name
HMGN2
Target Full Name
Non-histone chromosomal protein HMG-17
Target Function
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Cytoplasmic enrichment upon phosphorylation.
Target Protein Families
HMGN family
Target Research Area
others
Target Synonyms
High mobility group (nonhistone chromosomal) protein 17 ; high mobility group nucleosomal binding domain 2; High mobility group nucleosome-binding domain-containing protein 2; High mobility group protein N2 ; HMG17; HMGN2; HMGN2_HUMAN; MGC5629; Non histone chromosomal protein HMG 17; Non-histone chromosomal protein HMG-17; Nonhistone chromosomal protein HMG 17; nonhistone chromosomal protein hmg-17
Target Background
The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
