-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against hnRNP A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human hnRNP A1 (NP_002127.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against hnRNP A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human hnRNP A1 (NP_002127.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06380A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | hnRNP A1 |
| Target Synonyms | UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, HepG2, MCF7, Mouse brain, Mouse spinal cord, Rat spinal cord, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human hnRNP A1 (NP_002127.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR | Uniprot ID | P09651 |
Uniprot Id
P09651
Target Species
Human
Target Name
HNRNPA1
Target Full Name
Heterogeneous nuclear ribonucleoprotein A1
Target Function
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May bind to specific miRNA hairpins. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1.; (Microbial infection) May play a role in HCV RNA replication.; (Microbial infection) Cleavage by Enterovirus 71 protease 3C results in increased translation of apoptosis protease activating factor APAF1, leading to apoptosis.
Target Involvement
Inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3 (IBMPFD3); Amyotrophic lateral sclerosis 20 (ALS20)
Target Subcellular Location
Nucleus. Cytoplasm.; Cytoplasm.
Target Research Area
Immunology
Target Synonyms
HNRNPA 1; Helix destabilizing protein; Helix-destabilizing protein; Heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1B protein; Heterogeneous nuclear ribonucleoprotein B2 protein; Heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP core protein A1; HNRNPA1; HNRPA1; MGC102835; Nuclear ribonucleoprotein particle A1 protein; ROA1_HUMAN; Single strand DNA binding protein UP1; Single strand RNA binding protein; Single-strand RNA-binding protein
Target Background
This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.
Notification