Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXB5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-269 of human HOXB5 (NP_002138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HOXB5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-269 of human HOXB5 (NP_002138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXB5 |
| Target Synonyms | HOX2; HU-1; HOX2A; Hox2.1; HHO.C10; HOXB5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, Rat lung, U-937(negative) | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 170-269 of human HOXB5 (NP_002138.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP | Uniprot ID | P09067 |
Uniprot Id
P09067
Target Species
Human
Target Name
HOXB5
Target Full Name
Homeobox protein Hox-B5
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family
Target Tissue Specificity
Spinal cord.
Target Synonyms
HGNC:5116; HHO.C10; Homeo box 2A; Homeo box B5; Homeobox 2A; Homeobox B5; Homeobox protein HHO.C10; Homeobox protein Hox B5; Homeobox protein Hox-2A; Homeobox protein Hox-B5; Homeobox protein HoxB5; Homeobox protein Hu-1; Homeobox2A; HomeoboxB5; HOX 2; Hox 2.1; HOX 2A; HOX B5; HOX2; Hox2.1; Hox2.1, mouse, homolog of; HOX2A; HOXB 5; Hoxb5; HU 1; HU1; HXB5_HUMAN
Target Background
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
