-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 263-432 of human HOXD3 (NP_008829.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 263-432 of human HOXD3 (NP_008829.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05168A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXD3 |
| Target Synonyms | HOX4; HOX1D; HOX4A; Hox-4.1; HOXD3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 263-432 of human HOXD3 (NP_008829.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFASANLQGSPVYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCDPHPTYTDLSAHHSSQGRLPEAPKLTHL | Uniprot ID | P31249 |
Uniprot Id
P31249
Target Species
Human
Target Name
HOXD3
Target Full Name
Homeobox protein Hox-D3
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Subcellular Location
Nucleus.
Target Protein Families
Antp homeobox family
Target Synonyms
Homeo box D3 ; Homeobox D3; Homeobox protein Hox D3; Homeobox protein Hox-4A; Homeobox protein Hox-D3; Homeobox protein HoxD3; Homeodomain protein; HOX 1D; HOX 4; Hox 4.1; Hox 4A; HOX D3; Hox-4.1 mouse homolog of ; HOX1D; HOX4; Hox4.1; HOX4A; HOXD 3; HOXD3; HXD3_HUMAN; MGC10470
Target Background
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in the regulation of cell adhesion processes.
Notification