-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSP105/HSPH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 659-858 of human HSP105/HSP105/HSPH1 (NP_006635.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HSP105/HSPH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 659-858 of human HSP105/HSP105/HSPH1 (NP_006635.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09452A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSP105/HSPH1 |
| Target Synonyms | HSP105; HSP105A; HSP105B; NY-CO-25; HSP105/HSPH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, BT-474, HepG2, MCF7, Mouse brain, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 659-858 of human HSP105/HSP105/HSPH1 (NP_006635.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD | Uniprot ID | Q92598 |
Uniprot Id
Q92598
Target Species
Human
Target Name
HSPH1
Target Full Name
Heat shock protein 105 kDa
Target Function
Acts as a nucleotide-exchange factor (NEF) for chaperone proteins HSPA1A and HSPA1B, promoting the release of ADP from HSPA1A/B thereby triggering client/substrate protein release. Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Heat shock protein 70 family
Target Tissue Specificity
Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells.
Target Synonyms
Antigen NY CO 25; Antigen NY-CO-25; DKFZp686M05240; Heat shock 105kD alpha; Heat shock 105kD; Heat shock 105kD beta; Heat shock 105kDa protein 1; Heat shock 105kDa protein; Heat shock 105kDa/110kDa protein 1 ; Heat shock 110 kDa protein; Heat shock 110kDa protein; Heat shock protein 105 kDa; HS105_HUMAN; HSP105; HSP105A; HSP105B; HSP110; HSPH 1; Hsph1; KIAA0201; NY CO 25
Target Background
This gene encodes a member of the heat shock protein 70 family of proteins. The encoded protein functions as a nucleotide exchange factor for the molecular chaperone heat shock cognate 71 kDa protein (Hsc70). In addition, this protein plays a distinct but related role as a holdase that inhibits the aggregation of misfolded proteins, including the cystic fibrosis transmembrane conductance regulator (CFTR) protein. Elevated expression of this protein has been observed in numerous human cancers.
Notification