-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSP20/HSPB6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HSP20/HSPB6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14202A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSP20/HSPB6 |
| Target Synonyms | HEL55; Hsp20; PPP1R91; HSP20/HSPB6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS | Uniprot ID | O14558 |
Uniprot Id
O14558
Target Species
Human
Target Name
HSPB6
Target Full Name
Heat shock protein beta-6
Target Function
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity.
Target Subcellular Location
Cytoplasm. Nucleus. Secreted.
Target Protein Families
Small heat shock protein (HSP20) family
Target Synonyms
epididymis luminal protein 55; FLJ32389; Heat shock 20 kDa like protein p20 ; Heat shock 20 kDa-like protein p20; Heat shock protein alpha crystallin related B6; Heat shock protein beta 6 ; Heat shock protein beta-6; Heat shock protein; 20-KD; Heat-shock 27-KD protein 6; HEL55; Hsp20; HspB6; HSPB6_HUMAN
Target Background
This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.
Notification