-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSP40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
The antibody against HSP40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.
| Cat.No | ADA-16428A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSP40 |
| Target Synonyms | DNAJB1; HSPF1; Hdj1; Hsp40; RSPH16B; Sis1; dnaJ homolog subfamily B member 1; HSP40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, C2C12, Mouse plasma(Low expression control), Mouse testis, Rat testis | Application | ELISA, WB, FC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 241-340 of human DNAJB1/HSP40 (NP_006136.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI | Uniprot ID | P25685 |
Uniprot Id
P25685
Target Species
Human
Target Name
DNAJB1
Target Full Name
DnaJ homolog subfamily B member 1
Target Function
Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, nucleolus. Note=Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
Target Research Area
Neuroscience
Target Synonyms
DnaJ (Hsp40) homolog subfmaily B member 1; DNAJ 1; DNAJ B1; DnaJ heat shock protein family (Hsp40) member B1; DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; DNAJ1; DNAJB 1; Dnajb1; DNAJB1 protein; DNJB1_HUMAN; HDJ 1 ; HDJ-1; HDJ1; Heat shock 40 kDa protein 1; Heat shock 40kD protein 1; Heat shock protein 40; Hsp 40; HSP40; HSPF 1; HSPF1; Human DnaJ protein 1; Radial spoke 16 homolog B; RSPH16B; Sis1
Target Background
This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.
Notification