-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSP47/SERPINH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HSP47/SERPINH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16174A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSP47/SERPINH1 |
| Target Synonyms | CBP1; CBP2; OI10; gp46; AsTP3; HSP47; PIG14; PPROM; RA-A47; SERPINH2; HSP47/SERPINH1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL | Uniprot ID | P50454 |
Uniprot Id
P50454
Target Species
Human
Target Name
SERPINH1
Target Full Name
Serpin H1
Target Function
Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen.
Target Involvement
Osteogenesis imperfecta 10 (OI10)
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
Serpin family
Target Research Area
Signal Transduction
Target Synonyms
47 kDa heat shock protein; 47 kDa heat shock protein precursor; Arsenic transactivated protein 3; Arsenic-transactivated protein 3; AsTP 3; AsTP3; CBP 1; CBP 2; CBP1; CBP2; Cell proliferation-inducing gene 14 protein; Collagen binding protein 1; Collagen binding protein 2; Collagen binding protein; Collagen-binding protein 2; Collagen-binding protein; Colligen; Colligin 1; Colligin 2; Colligin; colligin-1; colligin-2; gp46; Heat shock protein 47; Heat-shock protein 47; HGNC 1547; Hsp 47; J6; OI10; PIG 14; PIG14; PPROM; Proliferation inducing gene 14; Proliferation inducing gene 14 protein; RA A47; RA-A47; Rheumatoid arthritis antigen A 47; rheumatoid arthritis antigen A-47; Rheumatoid arthritis related antigen RA A47; Rheumatoid arthritis-related antigen RA-A47; serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1); serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2); Serine or cysteine proteinase inhibitor clade H member 1; Serine or cysteine proteinase inhibitor clade H member 2; SERPH_HUMAN; Serpin H1; Serpin peptidase inhibitor clade H member 1; serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1); Serpin peptidase inhibitor, clade H, member 1; SERPINH1; SERPINH2
Target Background
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Notification