Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HUWE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HUWE1 (NP_113584.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HUWE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HUWE1 (NP_113584.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07611A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HUWE1 |
| Target Synonyms | MULE; Ib772; LASU1; MRXST; UREB1; HECTH9; URE-B1; ARF-BP1; HSPC272; HUWE1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HUWE1 (NP_113584.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFT | Uniprot ID | Q7Z6Z7 |
Uniprot Id
Q7Z6Z7
Target Species
Human
Target Name
HUWE1
Target Full Name
E3 ubiquitin-protein ligase HUWE1
Target Function
E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of target proteins. Regulates apoptosis by catalyzing the polyubiquitination and degradation of MCL1. Mediates monoubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair. Also ubiquitinates the p53/TP53 tumor suppressor and core histones including H1, H2A, H2B, H3 and H4. Ubiquitinates MFN2 to negatively regulate mitochondrial fusion in response to decreased stearoylation of TFRC. Ubiquitination of MFN2 also takes place following induction of mitophagy; AMBRA1 acts as a cofactor for HUWE1-mediated ubiquitination. Regulates neural differentiation and proliferation by catalyzing the polyubiquitination and degradation of MYCN. May regulate abundance of CDC6 after DNA damage by polyubiquitinating and targeting CDC6 to degradation. Mediates polyubiquitination of isoform 2 of PA2G4. Acts in concert with MYCBP2 to regulate the circadian clock gene expression by promoting the lithium-induced ubiquination and degradation of NR1D1. Binds to an upstream initiator-like sequence in the preprodynorphin gene
Target Involvement
Mental retardation, X-linked, syndromic, Turner type (MRXST); Mental retardation, X-linked 17 (MRX17)
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion.
Target Protein Families
UPL family, TOM1/PTR1 subfamily
Target Tissue Specificity
Weakly expressed in heart, brain and placenta but not in other tissues. Expressed in a number of cell lines, predominantly in those from colorectal carcinomas.
Target Research Area
Cell Biology
Target Synonyms
ARF binding protein 1; ARF BP1; ARF-binding protein 1; ARF-BP1; ARFBP1; BJ-HCC-24 tumor antigen; E3 ubiquitin protein ligase HUWE1; E3 ubiquitin-protein ligase HUWE1; HECT; HECT domain protein LASU1; HECT UBA and WWE domain containing protein 1; HectH9; Homologous to E6AP carboxyl terminus homologous protein 9; Huwe1; HUWE1_HUMAN; Ib772; Large structure of UREB1; LASU1; Mcl 1 ubiquitin ligase E3; Mcl-1 ubiquitin ligase E3; Mule; UBA and WWE domain-containing protein 1; Upstream regulatory element-binding protein 1; URE-B1; URE-binding protein 1; UREB1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
