Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFT81 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-676 of human IFT81 (NP_054774.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFT81 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-676 of human IFT81 (NP_054774.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03912A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFT81 |
| Target Synonyms | DV1; CDV1; CDV-1; CDV1R; CDV-1R; SRTD19; IFT81 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 550-676 of human IFT81 (NP_054774.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL | Uniprot ID | Q8WYA0 |
Uniprot Id
Q8WYA0
Target Species
Human
Target Name
IFT81
Target Full Name
Intraflagellar transport protein 81 homolog
Target Function
Component of the intraflagellar transport (IFT) complex B: together with IFT74, forms a tubulin-binding module that specifically mediates transport of tubulin within the cilium. Binds tubulin via its CH (calponin-homology)-like region. Required for ciliogenesis. Required for proper regulation of SHH signaling.
Target Subcellular Location
Cell projection, cilium.
Target Protein Families
IFT81 family
Target Tissue Specificity
Highly expressed in testis, moderately in ovary, heart, liver, skeletal muscle, kidney and pancreas, low in prostate, brain, placenta and lung and not detected in spleen, thymus, small intestine and colon. Isoform CDV-1R is abundantly expressed in testis.
Target Synonyms
Carnitine deficiency associated expressed in ventricle 1 isoform 2; Carnitine deficiency-associated protein expressed in ventricle 1; CDV-1; CDV1 ; CDV1R ; Ift81; IFT81_HUMAN; intraflagellar transport 81 homolog (Chlamydomonas); Intraflagellar transport protein 81 homolog
Target Background
The protein encoded by this gene, together with IFT74, forms a tubulin-binding module of intraflagellar transport complex B. This module is involved in transport of tubulin within the cilium, and the encoded protein is required for ciliogenesis. Mutations in this gene are a cause of short-rib polydactyly syndromes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
