-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-127 of human IGF2 (NP_000603.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against IGF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-127 of human IGF2 (NP_000603.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-05891A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGF2 |
| Target Synonyms | GRDF; SRS3; IGF-II; PP9974; C11orf43; IGF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-127 of human IGF2 (NP_000603.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFRE | Uniprot ID | P01344 |
Uniprot Id
P01344
Target Species
Human
Target Name
IGF2
Target Full Name
Insulin-like growth factor 2
Target Function
The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
Target Involvement
Silver-Russell syndrome (SRS); Growth restriction, severe, with distinctive facies (GRDF)
Target Subcellular Location
Secreted.
Target Protein Families
Insulin family
Target Tissue Specificity
Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas.
Target Research Area
Metabolism
Target Synonyms
C11orf43; IGF 2; IGF II; IGF-II; IGF2; IGF2_HUMAN; IGFII; INSIGF; insulin like growth factor 2 (somatomedin A) ; Insulin like Growth Factor 2; Insulin like growth factor II; Insulin like growth factor II precursor; Insulin like growth factor type 2; pp9974; Preptin; putative insulin like growth factor II associated protein; Somatomedin A; Somatomedin-A
Target Background
This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification