Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL18BP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-194 of human IL18BP (NP_001138529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IL18BP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-194 of human IL18BP (NP_001138529.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09483A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Il18bp |
| Target Synonyms | FVH; IL18BPa; IL18BP | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-194 of human IL18BP (NP_001138529.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG | Uniprot ID | O95998 |
Uniprot Id
O95998
Target Species
Human
Target Name
IL18BP
Target Full Name
Interleukin-18-binding protein
Target Function
Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Strongly expressed in heart, lung, placenta and spleen.
Target Synonyms
I18BP_HUMAN; IL-18BP; IL18 binding protein; IL18 BP; IL18 BPa; IL18BP; IL18BPa; Interleukin 18 binding protein; Interleukin-18-binding protein; MC51L 53L 54L homolog gene product; Tadekinig alfa; Tadekinig-alfa
Target Background
The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
