Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL20RB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 48-177 of human IL20RB (NP_653318.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL20RB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 48-177 of human IL20RB (NP_653318.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09160A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL20RB |
| Target Synonyms | DIRS1; FNDC6; IL-20R2; IL20RB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, MCF7, Mouse brain, Mouse liver, Mouse pancreas, Mouse thymus, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 48-177 of human IL20RB (NP_653318.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAE | Uniprot ID | Q6UXL0 |
Uniprot Id
Q6UXL0
Target Species
Human
Target Name
IL20RB
Target Full Name
Interleukin-20 receptor subunit beta
Target Function
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Type II cytokine receptor family
Target Tissue Specificity
Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin.
Target Research Area
Cancer
Target Synonyms
DIRS1 ; Fibronectin type III domain containing 6; FNDC6 ; I20RB_HUMAN; IL 20R beta ; IL 20R2; IL-20 receptor subunit beta; IL-20R-beta; IL-20R2; IL-20RB; IL20RB; Interleukin 20 receptor beta; Interleukin 20 receptor beta chain precursor ; Interleukin 20 receptor II; Interleukin-20 receptor subunit beta; MGC34923
Target Background
IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
