-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 351-451 of human IRF4 (NP_001182215.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against IRF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 351-451 of human IRF4 (NP_001182215.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-15187A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRF4 |
| Target Synonyms | MUM1; LSIRF; SHEP8; NF-EM5; IRF4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 351-451 of human IRF4 (NP_001182215.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE | Uniprot ID | Q15306 |
Uniprot Id
Q15306
Target Species
Human
Target Name
IRF4
Target Full Name
Interferon regulatory factor 4
Target Function
Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 and activation of genes.
Target Involvement
Multiple myeloma (MM)
Target Subcellular Location
Nucleus.
Target Protein Families
IRF family
Target Tissue Specificity
Lymphoid cells.
Target Synonyms
Interferon regulatory factor 4; IRF 4; IRF-4; Irf4; IRF4_HUMAN; LSIRF; Lymphocyte specific interferon regulatory factor; Lymphocyte specific IRF; Lymphocyte-specific interferon regulatory factor; Multiple myeloma oncogene 1; MUM 1; MUM1; NF EM5; NF-EM5; NFEM5; PU.1 interaction partner; Sfpi1/PU.1 interaction partner; Transcriptional activator PIP
Target Background
The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response to infection by virus, and in the regulation of interferon-inducible genes. This family member is lymphocyte specific and negatively regulates Toll-like-receptor (TLR) signaling that is central to the activation of innate and adaptive immune systems. A chromosomal translocation involving this gene and the IgH locus, t(6;14)(p25;q32), may be a cause of multiple myeloma. Alternatively spliced transcript variants have been found for this gene.
Notification