Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IRS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16937A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRS1 |
| Target Synonyms | HIRS-1; IRS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ | Uniprot ID | P35568 |
Uniprot Id
P35568
Target Species
Human
Target Name
IRS1
Target Full Name
Insulin receptor substrate 1
Target Function
May mediate the control of various cellular processes by insulin. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains such as phosphatidylinositol 3-kinase p85 subunit or GRB2. Activates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit.
Target Involvement
Diabetes mellitus, non-insulin-dependent (NIDDM)
Target Synonyms
HIRS 1; HIRS1; Insulin receptor substrate 1; IRS 1; IRS-1; IRS1; IRS1_HUMAN; OTTHUMP00000164234
Target Background
This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
