-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Islet1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Islet1 (P61371) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Islet1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Islet1 (P61371) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16772A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Islet1 |
| Target Synonyms | Isl-1; ISLET1; Islet1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, Rat pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Islet1 (P61371). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ | Uniprot ID | P61371 |
Uniprot Id
P61371
Target Species
Human
Target Name
ISL1
Target Full Name
Insulin gene enhancer protein ISL-1
Target Function
DNA-binding transcriptional activator. Recognizes and binds to the consensus octamer binding site 5'-ATAATTAA-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell (RGC) differentiation. Cooperates with the transcription factor POU4F2 to achieve maximal levels of expression of RGC target genes and RGC fate specification in the developing retina. Involved in the specification of motor neurons in cooperation with LHX3 and LDB1. Binds to insulin gene enhancer sequences. Essential for heart development. Marker of one progenitor cell population that give rise to the outflow tract, right ventricle, a subset of left ventricular cells, and a large number of atrial cells as well, its function is required for these progenitors to contribute to the heart. Controls the expression of FGF and BMP growth factors in this cell population and is required for proliferation and survival of cells within pharyngeal foregut endoderm and adjacent splanchnic mesoderm as well as for migration of cardiac progenitors into the heart.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in subsets of neurons of the adrenal medulla and dorsal root ganglion, inner nuclear and ganglion cell layers in the retina, the pineal and some regions of the brain.
Target Synonyms
Insulin gene enhancer protein ISL 1; Insulin gene enhancer protein ISL-1; Insulin related protein; ISL 1; ISL LIM homeobox 1; ISL1; ISL1 transcription factor LIM homeodomain; ISL1 transcription factor, LIM/homeodomain (islet 1); ISL1 transcription factor, LIM/homeodomain; ISL1_HUMAN; Islet-1; Islet1
Target Background
This gene encodes a member of the LIM/homeodomain family of transcription factors. The encoded protein binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. The encoded protein is central to the development of pancreatic cell lineages and may also be required for motor neuron generation. Mutations in this gene have been associated with maturity-onset diabetes of the young.
Notification