-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITSN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 750-850 of human ITSN1 (NP_001317941.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITSN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 750-850 of human ITSN1 (NP_001317941.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07271A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITSN1 |
| Target Synonyms | ITSN; SH3D1A; SH3P17; ITSN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SKOV3, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 750-850 of human ITSN1 (NP_001317941.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSA | Uniprot ID | Q15811 |
Uniprot Id
Q15811
Target Species
Human
Target Name
ITSN1
Target Full Name
Intersectin-1
Target Function
Adapter protein that provides a link between the endocytic membrane traffic and the actin assembly machinery. Acts as guanine nucleotide exchange factor (GEF) for CDC42, and thereby stimulates actin nucleation mediated by WASL and the ARP2/3 complex. Plays a role in the assembly and maturation of clathrin-coated vesicles. Recruits FCHSD2 to clathrin-coated pits. Involved in endocytosis of activated EGFR, and probably also other growth factor receptors. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR may involve association with DAB2. Promotes ubiquitination and subsequent degradation of EGFR, and thereby contributes to the down-regulation of EGFR-dependent signaling pathways. In chromaffin cells, required for normal exocytosis of catecholamines. Required for rapid replenishment of release-ready synaptic vesicles at presynaptic active zones. Inhibits ARHGAP31 activity toward RAC1.; Plays a role in synaptic vesicle endocytosis in brain neurons.
Target Subcellular Location
Endomembrane system. Cell junction, synapse, synaptosome. Cell projection, lamellipodium. Cell membrane. Membrane, clathrin-coated pit. Recycling endosome. Endosome. Cytoplasmic vesicle.; [Isoform 2]: Cytoplasm. Endomembrane system. Nucleus envelope.; [Isoform 5]: Endomembrane system.
Target Tissue Specificity
Isoform 1 is expressed almost exclusively in the brain. Isoform 2 is detected in brain, spleen, lung, liver, heart, skeletal muscle and kidney. Isoform 5 is primarily expressed in brain, spleen, lung and kidney (at protein level). Isoform 1 and isoform 2
Target Synonyms
Human intersectin SH3 domain containing protein SH3P17; Intersectin 1 SH3 domain protein; intersectin 1 short form variant 3; intersectin 1 short form variant, 11; Intersectin short form; intersectin short variant 12; Intersectin-1; Intersectin1; ITSN 1; ITSN; itsn1; ITSN1_HUMAN; MGC134948; MGC134949; OTTHUMP00000067855; OTTHUMP00000067856; OTTHUMP00000067857; OTTHUMP00000194810; OTTHUMP00000194811; OTTHUMP00000194812; OTTHUMP00000206688; SH3 domain containing protein 1A; SH3 domain protein 1A; SH3 domain-containing protein 1A; SH3D1A; SH3P17; Src homology 3 domain containing protein
Target Background
The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.
Notification