-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KAT9/Elp3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-547 of human KAT9/Elp3 (Q9H9T3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KAT9/Elp3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-547 of human KAT9/Elp3 (Q9H9T3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14209A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KAT9/Elp3 |
| Target Synonyms | KAT9; KAT9/Elp3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, K-562, MCF7, Mouse brain, Mouse testis, Rat lung, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-547 of human KAT9/Elp3 (Q9H9T3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNN | Uniprot ID | Q9H9T3 |
Uniprot Id
Q9H9T3
Target Species
Human
Target Name
ELP3
Target Full Name
Elongator complex protein 3
Target Function
Catalytic tRNA acetyltransferase subunit of the RNA polymerase II elongator complex, which is a component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. The elongator complex is required for multiple tRNA modifications, including mcm5U (5-methoxycarbonylmethyl uridine), mcm5s2U (5-methoxycarbonylmethyl-2-thiouridine), and ncm5U (5-carbamoylmethyl uridine). In the elongator complex, acts as a tRNA uridine(34) acetyltransferase by mediating formation of carboxymethyluridine in the wobble base at position 34 in tRNAs. May also act as a protein lysine acetyltransferase by mediating acetylation of target proteins; such activity is however unclear in vivo and recent evidences suggest that ELP3 primarily acts as a tRNA acetyltransferase. Involved in neurogenesis: regulates the migration and branching of projection neurons in the developing cerebral cortex, through a process depending on alpha-tubulin acetylation. Required for acetylation of GJA1 in the developing cerebral cortex.
Target Involvement
ELP3 genetic variations may be associated with an increased risk for neurodegeneration and motor neuron diseases.
Target Subcellular Location
Cytoplasm. Nucleus.; [Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.
Target Protein Families
ELP3 family
Target Tissue Specificity
Expressed in the cerebellum and spinal motor neurons.
Target Synonyms
DKFZp761L098; Elongation protein 3 homolog (S. cerevisiae); Elongation protein 3 homolog; ELONGATION PROTEIN 3; S. CEREVISIAE; HOMOLOG OF; elongator acetyltransferase complex subunit 3; Elongator complex protein 3; elp3; ELP3_HUMAN; FLJ10422; hELP3; Hypothetical protein DKFZp761L098; Kat9
Target Background
Enables acetyltransferase activity and phosphorylase kinase regulator activity. Involved in regulation of transcription by RNA polymerase II and tRNA wobble uridine modification. Located in cytosol and nucleolus. Part of elongator holoenzyme complex.
Notification