Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KBTBD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-612 of human KBTBD3 (NP_689646.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KBTBD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-612 of human KBTBD3 (NP_689646.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04590A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KBTBD3 |
| Target Synonyms | BKLHD3; KBTBD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse brain, Mouse testis, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 520-612 of human KBTBD3 (NP_689646.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSNRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWFSNLCA | Uniprot ID | Q8NAB2 |
Uniprot Id
Q8NAB2
Target Species
Human
Target Name
KBTBD3
Target Full Name
Kelch repeat and BTB domain-containing protein 3
Target Synonyms
KBTBD3; BKLHD3; Kelch repeat and BTB domain-containing protein 3; BTB and kelch domain-containing protein 3
Target Background
KBTBD3 (Kelch Repeat And BTB Domain Containing 3) is a Protein Coding gene. Diseases associated with KBTBD3 include Schizotypal Personality Disorder. An important paralog of this gene is KLHL24.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
