Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNAB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 285-404 of human KCNAB3 (NP_004723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNAB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 285-404 of human KCNAB3 (NP_004723.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05434A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNAB3 |
| Target Synonyms | AKR6A9; KCNA3B; KCNA3.1B; KV-BETA-3; KCNAB3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 285-404 of human KCNAB3 (NP_004723.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YPLACGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIAWCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK | Uniprot ID | O43448 |
Uniprot Id
O43448
Target Species
Human
Target Name
KCNAB3
Target Full Name
Voltage-gated potassium channel subunit beta-3
Target Function
Accessory potassium channel protein which modulates the activity of the pore-forming alpha subunit. Alters the functional properties of Kv1.5.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Shaker potassium channel beta subunit family
Target Tissue Specificity
Brain specific. Most prominent expression in cerebellum. Weaker signals detected in cortex, occipital lobe, frontal lobe and temporal lobe. Not detected in spinal cord, heart, lung, liver, kidney, pancreas, placenta and skeletal muscle.
Target Synonyms
AKR6A9 ; K; K(+) channel subunit beta-3; K+ channel beta 3 subunit; KCAB3_HUMAN; KCNA3.1B; KCNA3B ; KCNAB 3; Kcnab3; KV BETA 3; KV BETA3; Kv-beta-3; MGC116886 ; Voltage gated potassium channel subunit beta 3; Voltage-gated potassium channel subunit beta-3
Target Background
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodimer with the potassium voltage-gated channel, shaker-related subfamily, member 5 gene product and regulates the activity of the alpha subunit.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
