Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human KCNS2 (NP_065748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KCNS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human KCNS2 (NP_065748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04904A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNS2 |
| Target Synonyms | KV9.2; KCNS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human KCNS2 (NP_065748.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSR | Uniprot ID | Q9ULS6 |
Uniprot Id
Q9ULS6
Target Species
Human
Target Name
KCNS2
Target Full Name
Delayed-rectifier potassium channel regulatory subunit KCNS2
Target Function
Potassium channel subunit that does not form functional channels by itself. Can form functional heterotetrameric channels with KCNB1 and KCNB2; modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.2/KCNS2 sub-subfamily
Target Synonyms
KCNS2; KIAA1144; Potassium voltage-gated channel subfamily S member 2; Delayed-rectifier K(+ channel alpha subunit 2; Voltage-gated potassium channel subunit Kv9.2
Target Background
Predicted to enable voltage-gated potassium channel activity. Predicted to be involved in potassium ion transmembrane transport and regulation of delayed rectifier potassium channel activity. Predicted to be located in perinuclear region of cytoplasm and plasma membrane. Predicted to be part of voltage-gated potassium channel complex. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
