Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-830 of human KDM4C (NP_055876.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KDM4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-830 of human KDM4C (NP_055876.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse brain, using KDM4C Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-10895A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM4C |
| Target Synonyms | GASC1; JHDM3C; JMJD2C; TDRD14C; KDM4C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 640-830 of human KDM4C (NP_055876.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYG | Uniprot ID | Q9H3R0 |
Uniprot Id
Q9H3R0
Target Species
Human
Target Name
KDM4C
Target Full Name
Lysine-specific demethylase 4C
Target Function
Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate.
Target Subcellular Location
Nucleus.
Target Protein Families
JHDM3 histone demethylase family
Target Tissue Specificity
Overexpressed in several esophageal squamous cell carcinomas (ESCs).
Target Synonyms
bA146B14.1; GASC 1 protein; GASC-1 protein; GASC1; Gene amplified in squamous cell carcinoma 1 protein; JHDM3C; JmjC domain containing histone demethylation protein 3C; JmjC domain-containing histone demethylation protein 3C; JMJD2C; Jumonji domain containing 2C; Jumonji domain containing protein 2C; Jumonji domain-containing protein 2C; Kdm4c; KDM4C_HUMAN; Lysine (K) specific demethylase 4C; Lysine demethylase 4C; Lysine-specific demethylase 4C; TDRD14C; Tudor domain containing 14C
Target Background
This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and chromosome segregation. Chromosomal aberrations and changes in expression of this gene may be found in tumor cells. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
