-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KEAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human KEAP1 (NP_036421.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KEAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human KEAP1 (NP_036421.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12871A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Keap1 |
| Target Synonyms | INrf2; KLHL19; KEAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 301-400 of human KEAP1 (NP_036421.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMT | Uniprot ID | Q14145 |
Uniprot Id
Q14145
Target Species
Human
Target Name
KEAP1
Target Full Name
Kelch-like ECH-associated protein 1
Target Function
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that regulates the response to oxidative stress by targeting NFE2L2/NRF2 for ubiquitination. KEAP1 acts as a key sensor of oxidative and electrophilic stress: in normal conditions, the BCR(KEAP1) complex mediates ubiquitination and degradation of NFE2L2/NRF2, a transcription factor regulating expression of many cytoprotective genes. In response to oxidative stress, different electrophile metabolites trigger non-enzymatic covalent modifications of highly reactive cysteine residues in KEAP1, leading to inactivate the ubiquitin ligase activity of the BCR(KEAP1) complex, promoting NFE2L2/NRF2 nuclear accumulation and expression of phase II detoxifying enzymes. In response to selective autophagy, KEAP1 is sequestered in inclusion bodies following its interaction with SQSTM1/p62, leading to inactivation of the BCR(KEAP1) complex and activation of NFE2L2/NRF2. The BCR(KEAP1) complex also mediates ubiquitination of SQSTM1/p62, increasing SQSTM1/p62 sequestering activity and degradation. The BCR(KEAP1) complex also targets BPTF and PGAM5 for ubiquitination and degradation by the proteasome.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Broadly expressed, with highest levels in skeletal muscle.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Cytosolic inhibitor of Nrf2; INrf 2; INrf2; Keap 1; KEAP1; KEAP1_HUMAN; Kelch like ECH associated protein 1; Kelch like family member 19; Kelch like protein 19 ; Kelch-like ECH-associated protein 1; Kelch-like protein 19; KIAA0132; KLHL 19; KLHL19; MGC10630; MGC1114; MGC20887; MGC4407; MGC9454
Target Background
This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Notification