-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KHDRBS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KHDRBS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00401A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KHDRBS2 |
| Target Synonyms | SLM1; SLM-1; KHDRBS2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, K-562 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY | Uniprot ID | Q5VWX1 |
Uniprot Id
Q5VWX1
Target Species
Human
Target Name
KHDRBS2
Target Full Name
KH domain-containing, RNA-binding, signal transduction-associated protein 2
Target Function
RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. Can regulate alternative splicing of NRXN1 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners. Regulates cell-type specific alternative splicing of NRXN1 at AS4 and acts synergystically with SAM68 in exon skipping. In contrast acts antagonistically with SAM68 in NRXN3 exon skipping at AS4. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. May function as an adapter protein for Src kinases during mitosis.
Target Subcellular Location
Nucleus.
Target Protein Families
KHDRBS family
Target Tissue Specificity
Highly expressed in brain, lung, kidney and small intestine. Weakly expressed in placenta, liver, spleen, thymus, ovary and colon.
Target Synonyms
KH domain containing; RNA binding; signal transduction associated protein 2; 6330586C16Rik; bA535F17.1; FLJ38664; hSLM 1; hSLM-1; KH domain containing; RNA binding; signal transduction associated 2; KH domain-containing; KHDR2_HUMAN; khdrbs2; MGC26664; RNA-binding; Sam68 like mammalian protein 1; Sam68-like mammalian protein 1; signal transduction-associated protein 2; SLM 1; SLM-1; SLM1
Target Background
Predicted to enable mRNA binding activity and poly(A) binding activity. Predicted to be involved in regulation of alternative mRNA splicing, via spliceosome. Predicted to be located in nucleoplasm. Predicted to be active in nucleus.
Notification