-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIR3DL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 361-455 of human KIR3DL2 (NP_006728.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIR3DL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 361-455 of human KIR3DL2 (NP_006728.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01269A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIR3DL2 |
| Target Synonyms | 3DL2; p140; NKAT4; CD158K; NKAT-4; NKAT4B; KIR-3DL2; KIR3DL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, LO2, MCF7, Mouse liver, Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 361-455 of human KIR3DL2 (NP_006728.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF | Uniprot ID | P43630 |
Uniprot Id
P43630
Target Species
Human
Target Name
KIR3DL2
Target Full Name
Killer cell immunoglobulin-like receptor 3DL2
Target Function
Receptor on natural killer (NK) cells and T cells for MHC class I molecules. Upon binding of peptide-free HLA-F open conformer, negatively regulates NK and T cell effector functions. Acts as a receptor on astrocytes for HLA-F. Through interaction with HLA-F, may protect motor neurons from astrocyte-induced toxicity.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily
Target Tissue Specificity
Expressed in astrocytes.
Target Synonyms
KIR3DL2; CD158K; NKAT4; Killer cell immunoglobulin-like receptor 3DL2; CD158 antigen-like family member K; MHC class I NK cell receptor; Natural killer-associated transcript 4; NKAT-4; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL-5; CD antigen CD158k
Target Background
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification