-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLF10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16182A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF10 |
| Target Synonyms | EGRA; TIEG; TIEG1; EGR-alpha; KLF10 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Jurkat, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSD | Uniprot ID | Q13118 |
Uniprot Id
Q13118
Target Species
Human
Target Name
KLF10
Target Full Name
Krueppel-like factor 10
Target Function
Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcriptional activity. Regulates the circadian expression of genes involved in lipogenesis, gluconeogenesis, and glycolysis in the liver. Represses the expression of PCK2, a rate-limiting step enzyme of gluconeogenesis. May play a role in the cell cycle regulation.
Target Subcellular Location
Nucleus.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Synonyms
Early growth response; alpha; Early growth response; alpha like; EGR A; EGR alpha ; EGR(A); EGR-alpha; EGRA; Egral; EGRalpha; Gdnfif; KLF 10; KLF10; KLF10_HUMAN; Krueppel like factor 10; Krueppel like factor10; Krueppel-like factor 10; Kruppel like factor 10; mGIF; TGF-beta- inducible early gene; TGFB inducible early growth response 1; TGFB inducible early growth response; TGFB inducible early growth response protein 1; TGFB-inducible early growth response protein 1; TIEG 1; TIEG; TIEG-1; TIEG1; Transforming growth factor beta inducible early growth response; Transforming growth factor beta inducible early growth response protein 1; Transforming growth factor-beta-inducible early growth response protein 1; Zinc finger transcription factor TIEG
Target Background
This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants.
Notification