Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-389 of human KLF17 (NP_775755.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLF17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-389 of human KLF17 (NP_775755.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF17 |
| Target Synonyms | ZLF393; ZNF393; Zfp393; KLF17 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-389 of human KLF17 (NP_775755.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP | Uniprot ID | Q5JT82 |
Uniprot Id
Q5JT82
Target Species
Human
Target Name
KLF17
Target Full Name
Krueppel-like factor 17
Target Function
Transcription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5'-CACCC-3' sequence in the promoter of ID1, a key metastasis regulator in breast cancer, and repress its expression. May be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development.
Target Subcellular Location
Nucleus.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Synonyms
FLJ40160; KLF17; KLF17_HUMAN; Krueppel like factor 17; Krueppel-like factor 17; Novel zinc finger protein; RP4 675G8.1; RP4675G8.1; Zfp393; Zinc finger protein 393; ZNF393
Target Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to act upstream of or within gamete generation. Predicted to be located in nucleus. Predicted to be part of chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
