-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLK6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLK6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02109A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLK6 |
| Target Synonyms | hK6; Bssp; Klk7; SP59; PRSS9; PRSS18; KLK6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KLK6 (NP_002765.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK | Uniprot ID | Q92876 |
Uniprot Id
Q92876
Target Species
Human
Target Name
KLK6
Target Full Name
Kallikrein-6
Target Function
Serine protease which exhibits a preference for Arg over Lys in the substrate P1 position and for Ser or Pro in the P2 position. Shows activity against amyloid precursor protein, myelin basic protein, gelatin, casein and extracellular matrix proteins such as fibronectin, laminin, vitronectin and collagen. Degrades alpha-synuclein and prevents its polymerization, indicating that it may be involved in the pathogenesis of Parkinson disease and other synucleinopathies. May be involved in regulation of axon outgrowth following spinal cord injury. Tumor cells treated with a neutralizing KLK6 antibody migrate less than control cells, suggesting a role in invasion and metastasis.
Target Subcellular Location
Secreted. Nucleus, nucleolus. Cytoplasm. Mitochondrion. Microsome. Note=In brain, detected in the nucleus of glial cells and in the nucleus and cytoplasm of neurons. Detected in the mitochondrial and microsomal fractions of HEK-293 cells and released into the cytoplasm following cell stress.
Target Protein Families
Peptidase S1 family, Kallikrein subfamily
Target Tissue Specificity
In fluids, highest levels found in milk of lactating women followed by cerebrospinal fluid, nipple aspirate fluid and breast cyst fluid. Also found in serum, seminal plasma and some amniotic fluids and breast tumor cytosolic extracts. Not detected in urin
Target Synonyms
Bssp; hK 6; hK6; Kallikrein 6 precursor; Kallikrein related peptidase 6; Kallikrein-6; Kallikrein6; KLK 6; Klk 7; KLK 9; Klk29; Klk6; KLK6_HUMAN; Klk7; KLK9; MGC9355; mGK 1; mGK1; MSP; Neurosin; Protease M; Protease serine 18; Protease serine 9; PRSS 18; PRSS 9; PRSS18; PRSS9; Serine protease 18; Serine protease 9; SP 59; SP59; Tissue kallikrein; TK; Zyme
Target Background
This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification