Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KRBOX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KRBOX4 (NP_060246.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KRBOX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KRBOX4 (NP_060246.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05591A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KRBOX4 |
| Target Synonyms | ZNF673; KRBOX4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, 293T, HT-29, MCF7, Mouse testis, OVCAR3, Rat testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human KRBOX4 (NP_060246.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSFKLSWSKWKLCKKER | Uniprot ID | Q5JUW0 |
Uniprot Id
Q5JUW0
Target Species
Human
Target Name
KRBOX4
Target Full Name
KRAB domain-containing protein 4
Target Synonyms
Protein ZNF673; RP4-733D15.4; zinc finger family member 673 ; ZN673_HUMAN; ZNF673
Target Background
This encodes a zinc finger protein with an N-terminal KRAB (Kruppel-associated) domain found in transcriptional repressors. This gene is located in a region of the X chromosome thought to be involved in nonsyndromic X-linked cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
