-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAMP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 81-259 of human LAMP1 (NP_005552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAMP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 81-259 of human LAMP1 (NP_005552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07857A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAMP1 |
| Target Synonyms | LAMPA; CD107a; LGP120; LAMP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-1080, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 81-259 of human LAMP1 (NP_005552.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNIN | Uniprot ID | P11279 |
Uniprot Id
P11279
Target Species
Human
Target Name
LAMP1
Target Full Name
Lysosome-associated membrane glycoprotein 1
Target Function
Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis. Plays also an important role in NK-cells cytotoxicity. Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.; (Microbial infection) Acts as a receptor for Lassa virus glycoprotein. Promotes also fusion of the virus with host membrane in less acidic endosomes.; (Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Cytolytic granule membrane; Single-pass type I membrane protein.
Target Protein Families
LAMP family
Target Synonyms
LAMP1; Lysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; CD107 antigen-like family member A; CD antigen CD107a
Target Background
The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.
Notification