Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LASP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against LASP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-09779A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LASP1 |
| Target Synonyms | MLN50; Lasp-1; LASP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BT-474, LO2, Mouse brain, Mouse liver, SKOV3, U-87MG | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-205 of human LASP1 (NP_006139.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGK | Uniprot ID | Q14847 |
Uniprot Id
Q14847
Target Species
Human
Target Name
LASP1
Target Full Name
LIM and SH3 domain protein 1
Target Function
Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types.
Target Subcellular Location
Cytoplasm, cell cortex. Cytoplasm, cytoskeleton.
Target Research Area
Transport
Target Synonyms
LASP 1; LASP-1; LASP1; LASP1_HUMAN; LIM and SH3 domain protein 1; LIM and SH3 protein 1; Metastatic lymph node gene 50 protein; MLN 50; MLN50; OTTHUMP00000164238; OTTHUMP00000164239
Target Background
This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
