Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LDHC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human LDHC (NP_002292.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LDHC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human LDHC (NP_002292.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05319A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LDHC |
| Target Synonyms | CT32; LDH3; LDHX; LDHC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A549, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LDHC (NP_002292.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSW | Uniprot ID | P07864 |
Uniprot Id
P07864
Target Species
Human
Target Name
LDHC
Target Full Name
L-lactate dehydrogenase C chain
Target Function
Possible role in sperm motility.
Target Subcellular Location
Cytoplasm.
Target Protein Families
LDH/MDH superfamily, LDH family
Target Research Area
Cancer
Target Synonyms
Cancer/testis antigen 32; CT32; EC 1.1.1.27 ; L lactate dehydrogenase C chain; L-lactate dehydrogenase C chain; Lactate Dehydrogenase C; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; LDH C; LDH testis subunit; LDH X ; LDH-C; LDH-X; LDH3 ; ldhc; LDHC_HUMAN; LDHX ; MGC111073
Target Background
Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
