Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LHX2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LHX2 (P50458) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LHX2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LHX2 (P50458) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14360A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LHX2 |
| Target Synonyms | LH2; hLhx2; LHX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Neuro-2a, SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LHX2 (P50458). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSI | Uniprot ID | P50458 |
Uniprot Id
P50458
Target Species
Human
Target Name
LHX2
Target Full Name
LIM/homeobox protein Lhx2
Target Function
Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.
Target Subcellular Location
Nucleus.
Target Synonyms
hLhx2 ; Homeobox protein LH-2; Homeobox protein LH2; LH2; LHX2; LHX2_HUMAN; LIM homeobox 2; LIM homeobox protein 2; LIM HOX gene 2; LIM/homeobox protein Lhx2
Target Background
This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
