-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIN7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human LIN7A (NP_004655.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LIN7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human LIN7A (NP_004655.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05124A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIN7A |
| Target Synonyms | LIN7; MALS1; VELI1; LIN-7A; MALS-1; TIP-33; LIN7A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, MCF7, Mouse brain, Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human LIN7A (NP_004655.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATA | Uniprot ID | O14910 |
Uniprot Id
O14910
Target Species
Human
Target Name
LIN7A
Target Full Name
Protein lin-7 homolog A
Target Function
Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules. This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Basolateral cell membrane; Peripheral membrane protein. Cell junction. Cell junction, synapse, postsynaptic density membrane; Peripheral membrane protein. Cell junction, tight junction.
Target Protein Families
Lin-7 family
Target Tissue Specificity
Expressed in brain, testis, kidney, placenta and liver.
Target Synonyms
hLin-7; Lin 7 homolog A (C. elegans); LIN 7A; Lin-7A; LIN7; LIN7A; LIN7A_HUMAN; MALS-1; Mammalian LIN 7 1; Mammalian lin-seven protein 1; Protein lin-7 homolog A; Tax interaction protein 33; TIP-33; Veli-1; VELI1; Vertebrate lin-7 homolog 1; Vertebrate LIN7 homolog 1
Target Background
The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a protein complex that couples synaptic vesicle exocytosis to cell adhesion in the brain.
Notification