Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMOD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-187 of human LMOD1 (NP_036266.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LMOD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-187 of human LMOD1 (NP_036266.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded human colon using LMOD1 antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-02692A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMOD1 |
| Target Synonyms | 1D; D1; 64kD; MMIHS3; SMLMOD; SM-LMOD; LMOD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-187 of human LMOD1 (NP_036266.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKK | Uniprot ID | P29536 |
Uniprot Id
P29536
Target Species
Human
Target Name
LMOD1
Target Full Name
Leiomodin-1
Target Function
Mediates nucleation of actin filaments.
Target Subcellular Location
Cytoplasm, myofibril, sarcomere. Cytoplasm, cytoskeleton.
Target Protein Families
Tropomodulin family
Target Tissue Specificity
Detected in lung vascular smooth muscle (at protein level). Detected in thyroid and extraocular smooth muscle, but not skeletal muscle. Detected in heart, aorta, skeletal muscle, colon, urinary bladder, uterus, stomach, and small intestine.
Target Synonyms
1D; 64 kDa autoantigen 1D; 64 kDa autoantigen 1D3; 64 kDa autoantigen D1; 9530015K06Rik; D1; Leiomodin; Leiomodin-1; Lmod1; LMOD1_HUMAN; muscle form; SM LMOD; SM-Lmod; SMLMOD; Smooth muscle leiomodin; Thyroid associated ophthalmopathy autoantigen ; Thyroid-associated ophthalmopathy autoantigen
Target Background
The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
