Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LPAR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LPAR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07389A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LPAR4 |
| Target Synonyms | LPA4; P2Y9; GPR23; P2RY9; P2Y5-LIKE; LPAR4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse ovary, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF | Uniprot ID | Q99677 |
Uniprot Id
Q99677
Target Species
Human
Target Name
LPAR4
Target Full Name
Lysophosphatidic acid receptor 4
Target Function
Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1-alkyl- > 1-alkenyl-LPA.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
High expression in ovary. Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus and hippocampus.
Target Synonyms
LPAR4; GPR23; LPA4; P2RY9; Lysophosphatidic acid receptor 4; LPA receptor 4; LPA-4; G-protein coupled receptor 23; P2Y purinoceptor 9; P2Y9; P2Y5-like receptor; Purinergic receptor 9
Target Background
This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
