Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRFN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-530 of human LRFN3 (NP_078785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRFN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-530 of human LRFN3 (NP_078785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05368A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRFN3 |
| Target Synonyms | SALM4; FIGLER1; LRFN3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HT-29, Mouse small intestine, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-530 of human LRFN3 (NP_078785.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKVADTGPPTDRGVQVTEHGATAALVQWPDQRPIPGIRMYQIQYNSSADDILVYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFSTEPALRPCGAP | Uniprot ID | Q9BTN0 |
Uniprot Id
Q9BTN0
Target Species
Human
Target Name
LRFN3
Target Full Name
Leucine-rich repeat and fibronectin type-III domain-containing protein 3
Target Function
Cell adhesion molecule that mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Promotes neurite outgrowth in hippocampal neurons.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse. Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, postsynaptic cell membrane.
Target Protein Families
LRFN family
Target Synonyms
LRFN3; SALM4; UNQ5865/PRO34192Leucine-rich repeat and fibronectin type-III domain-containing protein 3; Synaptic adhesion-like molecule 4
Target Background
Predicted to be involved in regulation of presynapse assembly; regulation of synaptic membrane adhesion; and synaptic membrane adhesion. Predicted to be located in plasma membrane. Predicted to be active in cell surface and glutamatergic synapse. Predicted to be integral component of postsynaptic density membrane and integral component of presynaptic active zone membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
