Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRP10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-120 of human LRP10 (NP_054764.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRP10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-120 of human LRP10 (NP_054764.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00614A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRP10 |
| Target Synonyms | LRP9; LRP-10; MST087; MSTP087; LRP10 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 17-120 of human LRP10 (NP_054764.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAG | Uniprot ID | Q7Z4F1 |
Uniprot Id
Q7Z4F1
Target Species
Human
Target Name
LRP10
Target Full Name
Low-density lipoprotein receptor-related protein 10
Target Function
Probable receptor, which is involved in the internalization of lipophilic molecules and/or signal transduction. May be involved in the uptake of lipoprotein APOE in liver.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Membrane, coated pit.
Target Protein Families
LDLR family
Target Tissue Specificity
Expressed in blood leukocyte, lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, skeletal muscle and heart.
Target Synonyms
LRP10; MSTP087; SP220; UNQ389/PRO724Low-density lipoprotein receptor-related protein 10; LRP-10
Target Background
This gene encodes a low density lipoprotein receptor family protein. A similar protein in mouse is thought to play a role in the uptake of apolipoprotein E-containing lipoproteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
