-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LY6E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human LY6E (NP_002337.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LY6E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human LY6E (NP_002337.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10367A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ly6e |
| Target Synonyms | RIGE; SCA2; RIG-E; SCA-2; TSA-1; LY6E | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human LY6E (NP_002337.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS | Uniprot ID | Q16553 |
Uniprot Id
Q16553
Target Species
Human
Target Name
LY6E
Target Full Name
Lymphocyte antigen 6E
Target Function
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Tissue Specificity
Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.
Target Research Area
Cell Biology
Target Synonyms
LY6E; 9804; RIGE; SCA2; TSA1; Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1
Target Background
This gene belongs to the human Ly6 gene family and encodes a glycosylphosphatidyl-inositol (GPI)-anchored cell surface protein. The protein plays an important role in T cell physiology, oncogenesis and immunological regulation. The protein is also involved in modulation of viral infection by coronaviruses, SARS-CoV, MERS-CoV and SARS-CoV-2.
Notification