Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYPLA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 147-231 of human LYPLA2 (NP_009191.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LYPLA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 147-231 of human LYPLA2 (NP_009191.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04832A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYPLA2 |
| Target Synonyms | APT2; APT-2; DJ886K2.4; LYPLA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, Mouse brain, Mouse thymus, Raji, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 147-231 of human LYPLA2 (NP_009191.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV | Uniprot ID | O95372 |
Uniprot Id
O95372
Target Species
Human
Target Name
LYPLA2
Target Full Name
Acyl-protein thioesterase 2
Target Function
Acts as a acyl-protein thioesterase hydrolyzing fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins, GAP43, ZDHHC6 or HRAS. Deacylates GAP43. Mediates depalmitoylation of ZDHHC6. Has lysophospholipase activity. Hydrolyzes prostaglandin glycerol esters (PG-Gs) in the following order prostaglandin D2-glycerol ester (PGD2-G) > prostaglandin E2 glycerol ester (PGE2-G) > prostaglandin F2-alpha-glycerol ester (PGF2-alpha-G). Hydrolyzes 1-arachidonoylglycerol but not 2-arachidonoylglycerol or arachidonoylethanolamide.
Target Subcellular Location
Cytoplasm.
Target Protein Families
AB hydrolase superfamily, AB hydrolase 2 family
Target Tissue Specificity
Expressed in various breast cancer cell lines.
Target Research Area
Metabolism
Target Synonyms
Acyl protein thioesterase 2; Acyl protein thioesterase; Acyl-protein thioesterase 2; APT 2; APT-2; APT2; DJ886K2.4; EC 3.1.2.- ; LPL I; LPL II; LPL-II; LYPA2_HUMAN; LYPLA 2; Lypla2; Lysophospholipase II; LysoPLA II; OTTHUMP00000002999; OTTHUMP00000044831
Target Background
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
