-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYVE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYVE1 (Q9Y5Y7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LYVE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYVE1 (Q9Y5Y7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16059A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYVE1 |
| Target Synonyms | HAR; XLKD1; LYVE-1; CRSBP-1; LYVE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, Mouse brain, Mouse lung, Rat lung, Rat uterus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYVE1 (Q9Y5Y7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRI | Uniprot ID | Q9Y5Y7 |
Uniprot Id
Q9Y5Y7
Target Species
Human
Target Name
LYVE1
Target Full Name
Lymphatic vessel endothelial hyaluronic acid receptor 1
Target Function
Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Note=Localized to the plasma membrane and in vesicles near extranuclear membranes which may represent trans-Golgi network (TGN) and endosomes/prelysosomeal compartments. Undergoes ligand-dependent internalization and recycling at the cell surface.
Target Tissue Specificity
Mainly expressed in endothelial cells lining lymphatic vessels.
Target Synonyms
Cell surface retention sequence-binding protein 1; CRSBP 1; CRSBP-1; CRSBP1; extracellular link domain containing 1; extracellular link domain-containing 1; Extracellular link domain-containing protein 1; HAR; Hyaluronic acid receptor; Lymphatic endothelium specific hyaluronan receptor ; lymphatic vessel endothelial hyaluronan receptor 1; Lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1; LYVE-1; LYVE1; LYVE1_HUMAN; XLKD1
Target Background
This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
Notification