Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAFK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human MAFK (NP_002351.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAFK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human MAFK (NP_002351.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10506A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAFK |
| Target Synonyms | P18; NFE2U; MAFK | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human MAFK (NP_002351.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVT | Uniprot ID | O60675 |
Uniprot Id
O60675
Target Species
Human
Target Name
MAFK
Target Full Name
Transcription factor MafK
Target Function
Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they act as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1/NRF1, NFE2L2/NRF2 and NFE2L3/NRF3, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Maf subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Erythroid transcription factor NF E2 p18 subunit ; Erythroid transcription factor NF-E2 p18 subunit; FLJ32205; MAFK; MAFK_HUMAN; MGC71717 ; Nfe2u; P18; Transcription factor MafK; V maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
