Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAS1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAS1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11346A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAS1L |
| Target Synonyms | MRG; MAS-L; dJ994E9.2; MAS1L | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ | Uniprot ID | P35410 |
Uniprot Id
P35410
Target Species
Human
Target Name
MAS1L
Target Full Name
Mas-related G-protein coupled receptor MRG
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Target Synonyms
MAS1L; MRG; Mas-related G-protein coupled receptor MRG; MAS-R; MAS1-like
Target Background
Predicted to enable G protein-coupled receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in cytosol; nucleoplasm; and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
