-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEAF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human MEAF6 (NP_001257804.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEAF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human MEAF6 (NP_001257804.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05529A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEAF6 |
| Target Synonyms | EAF6; CENP-28; C1orf149; NY-SAR-91; MEAF6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human MEAF6 (NP_001257804.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY | Uniprot ID | Q9HAF1 |
Uniprot Id
Q9HAF1
Target Species
Human
Target Name
MEAF6
Target Full Name
Chromatin modification-related protein MEAF6
Target Function
Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Target Involvement
A chromosomal aberration involving MEAF6 may be a cause of endometrial stromal tumors. Translocation t(1;6)(p34;p21) with PHF1.
Target Subcellular Location
Nucleus, nucleolus. Chromosome, centromere, kinetochore.
Target Protein Families
EAF6 family
Target Synonyms
MEAF6; C1orf149; CENP-28; EAF6Chromatin modification-related protein MEAF6; MYST/Esa1-associated factor 6; Esa1-associated factor 6 homolog; Protein EAF6 homolog; hEAF6; Sarcoma antigen NY-SAR-91
Target Background
This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants.
Notification