-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEF2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MEF2A (NP_005578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MEF2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MEF2A (NP_005578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00045A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEF2A |
| Target Synonyms | mef2; ADCAD1; RSRFC4; RSRFC9; MEF2A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MEF2A (NP_005578.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTS | Uniprot ID | Q02078 |
Uniprot Id
Q02078
Target Species
Human
Target Name
MEF2A
Target Full Name
Myocyte-specific enhancer factor 2A
Target Function
Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Also involved in the activation of numerous growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. In cerebellar granule neurons, phosphorylated and sumoylated MEF2A represses transcription of NUR77 promoting synaptic differentiation. Associates with chromatin to the ZNF16 promoter.
Target Involvement
Coronary artery disease, autosomal dominant, 1 (ADCAD1)
Target Subcellular Location
Nucleus.
Target Protein Families
MEF2 family
Target Tissue Specificity
Isoform MEF2 and isoform MEFA are expressed only in skeletal and cardiac muscle and in the brain. Isoform RSRFC4 and isoform RSRFC9 are expressed in all tissues examined.
Target Synonyms
ADCAD1; MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A) ; MEF2; MEF2A; MEF2A_HUMAN; Myocyte enhancer factor 2A; Myocyte-specific enhancer factor 2A; RSRFC4; RSRFC9; Serum response factor like protein 1 ; Serum response factor-like protein 1
Target Background
The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene.
Notification