-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEF2D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 431-521 of human MEF2D (NP_005911.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEF2D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 431-521 of human MEF2D (NP_005911.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00312A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEF2D |
| Target Synonyms | MEF2D | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 431-521 of human MEF2D (NP_005911.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK | Uniprot ID | Q14814 |
Uniprot Id
Q14814
Target Species
Human
Target Name
MEF2D
Target Full Name
Myocyte-specific enhancer factor 2D
Target Function
Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis.
Target Subcellular Location
Nucleus. Note=Translocated by HDAC4 to nuclear dots.
Target Protein Families
MEF2 family
Target Synonyms
DKFZp686I1536; MADS box transcription factor 2 polypeptide D; Mef2d; MEF2D_HUMAN; Myocyte enhancer factor 2D; Myocyte specific enhancer factor 2, polypeptide D; Myocyte specific enhancer factor 2D; Myocyte-specific enhancer factor 2D
Target Background
This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants.
Notification