-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MGAT5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 616-790 of human MGAT5B (NP_653278.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MGAT5B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 616-790 of human MGAT5B (NP_653278.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05978A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MGAT5B |
| Target Synonyms | GnT-IX; GnT-VB; MGAT5B | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 616-790 of human MGAT5B (NP_653278.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL | Uniprot ID | Q3V5L5 |
Uniprot Id
Q3V5L5
Target Species
Human
Target Name
MGAT5B
Target Full Name
Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
Target Function
Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAc-beta1,2-Man-alpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAc-beta1,2-Man-alpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 18 family
Target Tissue Specificity
Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus.
Target Synonyms
MGAT5B; KIAA2008Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B; EC 2.4.1.-; EC 2.4.1.155; Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B; GlcNAc-T Vb; GNT-Vb; hGnTVb; Mannoside acetylglucosaminyltransferase 5B; N-acetylglucosaminyl-transferase Vb; N-acetylglucosaminyltransferase IX; GNT-IX
Target Background
Enables alpha-1, 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity and manganese ion binding activity. Involved in protein O-linked glycosylation via serine. Predicted to be located in Golgi membrane. Predicted to be integral component of membrane. Predicted to be active in Golgi apparatus.
Notification