Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Moesin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 458-557 of human Moesin (NP_002435.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Moesin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 458-557 of human Moesin (NP_002435.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06364A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Moesin |
| Target Synonyms | HEL70; IMD50; Moesin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, DU145, HepG2, HT-1080, Jurkat, Mouse lung, Mouse thymus, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 458-557 of human Moesin (NP_002435.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYK | Uniprot ID | P26038 |
Uniprot Id
P26038
Target Species
Human
Target Name
MSN
Target Full Name
Moesin
Target Function
Ezrin-radixin-moesin (ERM) family protein that connects the actin cytoskeleton to the plasma membrane and thereby regulates the structure and function of specific domains of the cell cortex. Tethers actin filaments by oscillating between a resting and an activated state providing transient interactions between moesin and the actin cytoskeleton. Once phosphorylated on its C-terminal threonine, moesin is activated leading to interaction with F-actin and cytoskeletal rearrangement. These rearrangements regulate many cellular processes, including cell shape determination, membrane transport, and signal transduction. The role of moesin is particularly important in immunity acting on both T and B-cells homeostasis and self-tolerance, regulating lymphocyte egress from lymphoid organs. Modulates phagolysosomal biogenesis in macrophages. Participates also in immunologic synapse formation.
Target Involvement
Immunodeficiency 50 (IMD50)
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Apical cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, microvillus membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, microvillus.
Target Tissue Specificity
In all tissues and cultured cells studied.
Target Synonyms
Epididymis luminal protein 70; HEL70; Membrane organizing extension spike protein; Membrane-organizing extension spike protein; MOES_HUMAN; Moesin; Moesin/anaplastic lymphoma kinase fusion protein; Msn; MSN/ALK fusion
Target Background
Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
